PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2983s0206.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 910aa    MW: 101439 Da    PI: 9.0854
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2983s0206.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.24.1e-0666122157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Bostr.2983s0206.1.p  66 KRPRDLLNPKAVKYLQAFFAVKDAISKKESREISALFGITVAQVRDFFVTQKTRVRK 122
                          799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.68563123IPR001356Homeobox domain
SMARTSM003892.0E-465127IPR001356Homeobox domain
SuperFamilySSF466896.84E-666127IPR009057Homeodomain-like
CDDcd000860.0012166123No hitNo description
Gene3DG3DSA:1.10.10.608.8E-566125IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.109.5E-5228322IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476764.71E-5231324IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 910 aa     Download sequence    Send to blast
MDAFKEEIEI GSSVESLMEL LDSQKELFHS QIDQLQDVVV TQCKLTGVNP LAQEMAAGAL  60
SIKIGKRPRD LLNPKAVKYL QAFFAVKDAI SKKESREISA LFGITVAQVR DFFVTQKTRV  120
RKQVRLSREK IIMSNTDALQ DDCIPENNNA TNHVDPVPLN STHPEACSIS WGEGETVALM  180
PPEDIPPDIS DSDKYFVENI FSLLRKEETF SGQVKLMEWI MQIQDSSVLI WFLSKGGVLI  240
LTTWLSQAAV EEQTSVLLLI LKVLCHLPLH KASPENMSAI LQSVNRLRFY RTSDISNRAK  300
GLLSRWTKLF AKIQAMKKQN RNNSQIDSQS QLLLKQSIAE IMGDSSNPED ILSLSNGRSE  360
NVRRFESSQG PKLLLTSADD STKKPMLGST PSYNKERRKV QMVEQPGQKA AGKSPQTVRI  420
GTSSRSRPMS ADDIQKAKMR ALYMQSKNSK KDPLPSAIGD SRTIVPEKPL ALQSAKDFQP  480
SQNNEARTED THVPSAVQPV NGPAVIVPVQ ADEIKKPLTP PKSIASKMGI LVKMSPQTIL  540
KNCKRKQIDW HVPPGMELDE LWRVAVGGNS KEADVQRNRN RRERETTYQS LQTIPLNPKE  600
PWDREMDFDD SLTPEIPSQQ QPEESLTEPQ DSLDERRTTA GAATTSSSLS TPEPDLELLA  660
ALLKNPDLVY ALTSGKPSNL AGQDMVKLLD VIKTGAPNSS SSSNKQVEEK VEVSLPSPTP  720
STNPGMWGQE AVRNPFSRRN QVGAAVARSG TQLHVASMQW QSTNEQSIPR HATAAYNNSP  780
ILPHTERQQH NMQQELHHNH HLQQPISTTS YAVREPVGLM GTAISGSWRS QQSQNSYYPH  840
QANEIASASQ ASSHQGNNQY MSSNRGYESW SPDHSPSRNH PNMRGQQQQP SRKHDSSSHP  900
YWNQNKRWR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1382398KKPMLGSTPSYNKERRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422575.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein